A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10097
Swiss-prot Accession number	P83486 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormone B (CHHB).
Source organism	Cherax destructor (Yabbie)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Parastacoidea; Parastacidae; Cherax.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	N/A
Post translational modification	Stereoinversion of L-Phe (in CHHB-I) to D-Phe (in CHHB-II).
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	72 Amino acids
Molecular weight	8395
References	1  PubMed abstract 15127939
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone B
Mature Hormone Sequence	QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVATSCRQNCYSNLVFRQCLDDLLLVDVVDEYVSGVQIV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (1-72)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10098
Swiss-prot Accession number	Q25154 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormones isoform B precursor [Contains: CHHprecursor-related peptide B (CPRP-B); Crustacean hyperglycemic hormoneB (CHH-B)].
Source organism	Homarus americanus (American lobster)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Nephropoidea; Nephropidae; Homarus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system
Post translational modification	Stereoinversion of L-Phe (form CHH-B-I) to D-Phe (form CHH-B- II).
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	134 Amino acids
Molecular weight	15050
References	1  PubMed abstract 7999796 2  PubMed abstract 1879416 3  PubMed abstract 1788131 4  PubMed abstract 8034574
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone B
Mature Hormone Sequence	QVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (61-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10517
Swiss-prot Accession number	Q9NGP0 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormones B precursor (CHH-B) (MeCHH-B)[Contains: CHH precursor-related peptide B (CPRP B); Crustaceanhyperglycemic hormone B (CHH B)].
Source organism	Metapenaeus ensis (Greasyback shrimp) (Sand shrimp)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Metapenaeus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Expressed at a constant level in the eyestalks of juveniles and mature females. A low level expression is seen in the central nervous system
Post translational modification	N/A
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	113 Amino acids
Molecular weight	12937
References	1  PubMed abstract 10781818
Domain Name	N/A
Hormone Name	Crustacean hyperglycemic hormone B
Mature Hormone Sequence	SLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (40-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated